question-mark
Stuck on an issue?

Lightrun Answers was designed to reduce the constant googling that comes with debugging 3rd party libraries. It collects links to all the places you might be looking at while hunting down a tough bug.

And, if you’re still stuck at the end, we’re happy to hop on a call to see how we can help out.

AttributeError: "'data'" in config_dict.py

See original GitHub issue

What is your question? I get a weird error that I cannot interpret. I report below the code to reproduce it.

Computational environment OS: Linux CentOS 7.

Cuda:

nvcc --version
nvcc: NVIDIA (R) Cuda compiler driver
Copyright (c) 2005-2022 NVIDIA Corporation
Built on Tue_May__3_18:49:52_PDT_2022
Cuda compilation tools, release 11.7, V11.7.64
Build cuda_11.7.r11.7/compiler.31294372_0
gcc --version
gcc (conda-forge gcc 12.1.0-16) 12.1.0
Copyright (C) 2022 Free Software Foundation, Inc.

To Reproduce Steps to reproduce the behavior:

input:

cat short_seqs2.fasta

>short_seq
PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASK
>qes_trohs
KSALEGGIGFHGKAMETIIVRVSTLPADLSRSIAESVERILTEKQEDSRGELIHIQAIP

Run as:

colabfold_batch --amber --templates --num-recycle 5 --use-gpu-relax --num-models 1 --model-type AlphaFold2-multimer-v1 short_seqs2.fasta ~/output/CF/short_seqs2

Errors I get to stderr:

WARNING: You are welcome to use the default MSA server, however keep in mind that it's a limited shared resource only capable of processing a few thousand MSAs per day. Please submit jobs only from a single IP address. We reserve the right to limit access to the server case-by-case when usage exceeds fair use.

If you require more MSAs:

* You can precompute all MSAs with `colabfold_search` or

* You can host your own API and pass it to `--host-url`
COMPLETE: 100%|██████████| 150/150 [elapsed: 00:03 remaining: 00:00]
Traceback (most recent call last):
  File "/users/software/miniconda/envs/colabfold/lib/python3.7/site-packages/ml_collections/config_dict/config_dict.py", line 903, in __getitem__
    field = self._fields[key]
KeyError: 'data'

During handling of the above exception, another exception occurred:

Traceback (most recent call last):
  File "/users/software/miniconda/envs/colabfold/lib/python3.7/site-packages/ml_collections/config_dict/config_dict.py", line 827, in __getattr__
    return self[attribute]
  File "/users/software/miniconda/envs/colabfold/lib/python3.7/site-packages/ml_collections/config_dict/config_dict.py", line 909, in __getitem__
    raise KeyError(self._generate_did_you_mean_message(key, str(e)))
KeyError: "'data'"

During handling of the above exception, another exception occurred:

Traceback (most recent call last):
  File "/users/software/miniconda/envs/colabfold/bin/colabfold_batch", line 8, in <module>
    sys.exit(main())
  File "/users/software/miniconda/envs/colabfold/lib/python3.7/site-packages/colabfold/batch.py", line 1752, in main
    stop_at_score_below=args.stop_at_score_below,
  File "/users/software/miniconda/envs/colabfold/lib/python3.7/site-packages/colabfold/batch.py", line 1385, in run
    random_seed=random_seed,
  File "/users/software/miniconda/envs/colabfold/lib/python3.7/site-packages/colabfold/batch.py", line 350, in predict_structure
    use_templates,
  File "/users/software/miniconda/envs/colabfold/lib/python3.7/site-packages/colabfold/batch.py", line 279, in batch_input
    eval_cfg = model_config.data.eval
  File "/users/software/miniconda/envs/colabfold/lib/python3.7/site-packages/ml_collections/config_dict/config_dict.py", line 829, in __getattr__
    raise AttributeError(e)
AttributeError: "'data'"

stdout

2022-07-08 21:27:28,528 Running colabfold 1.3.0 (2a47c6f1459fbbdb5242cbc62173f9b513813cfa)
2022-07-08 21:27:34,541 --max-msa can not be used in combination with AlphaFold2-multimer (--max-msa ignored)
2022-07-08 21:28:03,707 Found 8 citations for tools or databases
2022-07-08 21:28:08,801 Query 1/2: short_seq (length 59)
2022-07-08 21:28:18,966 Sequence 0 found templates: ['6bgn_J', '2op8_A', '2opa_A', '4faz_C', '6ogm_D', '6ogm_J', '2x4k_A', '3ry0_A', '3ry0_B', '4fdx_A', '4fdx_B', '3ej3_B', '3ej3_L', '3ej9_D', '2orm_A', '2orm_C', '3m21_C', '3mb2_A', '3m20_A', '3m20_C']
2022-07-08 21:28:19,286 Running model_3

Expected behavior I was hoping to be able to run a multimer type prediction, but no pdb file is computed. I can run single protein prediction without problem, I first encountered this problem when using a multifasta file for a multimer prediction.

ls -1 ~/output/CF/short_seqs2

cite.bibtex
config.json
log.txt
short_seq.a3m
short_seq_env
ls -1 ~/output/CF/short_seqs2/short_seq_env

bfd.mgnify30.metaeuk30.smag30.a3m
msa.sh
out.tar.gz
pdb70.m8
templates_101
uniref.a3m

Issue Analytics

  • State:open
  • Created a year ago
  • Comments:10 (3 by maintainers)

github_iconTop GitHub Comments

1reaction
18217265596commented, Jul 19, 2022

@YoshitakaMo i did produce that problem but i think its a format issue

format like that short_seq worked fine last night i guess no ploblem now thanks

1reaction
18217265596commented, Jul 18, 2022

same problem report

Read more comments on GitHub >

github_iconTop Results From Across the Web

How to fix AttributeError: 'ConfigDict' object has no attribute ...
... ex AttributeError: 'ConfigDict' object has no attribute 'data'. I was expecting an output where the image detects the class pantograph.
Read more >
'ConfigDict' object has no attribute 'test_pipeline' · Issue ...
Hi, the error is definitely resolved for COCO configs(mmpose) but same error still exists when testing on MPII configs(mmpose). Here is the ...
Read more >
logging.config — Logging configuration
If an error is encountered during configuration, this function will raise a ValueError , TypeError , AttributeError or ImportError with a suitably descriptive ......
Read more >
'NoneType' object has no attribute '_log' `when trying to run ...
I was calling my test function outside of wandb(only used wandb for training)and wandb must have call .finish so, it must have set...
Read more >
Source code for mmcv.utils.config
[docs]class ConfigDict(Dict): def __missing__(self, name): raise ... "/home/kchen/projects/mmcv/tests/data/config/a.py" >>> cfg.item4 'test' >>> cfg "Config ...
Read more >

github_iconTop Related Medium Post

No results found

github_iconTop Related StackOverflow Question

No results found

github_iconTroubleshoot Live Code

Lightrun enables developers to add logs, metrics and snapshots to live code - no restarts or redeploys required.
Start Free

github_iconTop Related Reddit Thread

No results found

github_iconTop Related Hackernoon Post

No results found

github_iconTop Related Tweet

No results found

github_iconTop Related Dev.to Post

No results found

github_iconTop Related Hashnode Post

No results found